Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPANXC Peptide - N-terminal region

SPANXC Peptide - N-terminal region

Product Specifications

Product Name Alternative

C, CT11.3, CTp11, SPANX-C

UniProt

Q9NY87

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPANXC Rabbit Polyclonal Antibody (orb584501) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_073152

Preservative

Lyophilized powder

AA Sequence

EVNETMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNVKRTSPEELLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crystallin Alpha B (CPTC-CRYAB-1), 1mg/mL
BNUM2235-50 1x 50 µL

Crystallin Alpha B (CPTC-CRYAB-1), 1mg/mL

Sign In for Pricing
View Details
Canine Calcium-binding and coiled-coil domain-containing protein 2 (CALCOCO2) ELISA Kit
MBS7232532-01 48 Well

Canine Calcium-binding and coiled-coil domain-containing protein 2 (CALCOCO2) ELISA Kit

Sign In for Pricing
View Details
Canine Calcium-binding and coiled-coil domain-containing protein 2 (CALCOCO2) ELISA Kit
MBS7232532-02 96 Well

Canine Calcium-binding and coiled-coil domain-containing protein 2 (CALCOCO2) ELISA Kit

Sign In for Pricing
View Details
Canine Calcium-binding and coiled-coil domain-containing protein 2 (CALCOCO2) ELISA Kit
MBS7232532-03 5x 96 Well

Canine Calcium-binding and coiled-coil domain-containing protein 2 (CALCOCO2) ELISA Kit

Sign In for Pricing
View Details
Canine Calcium-binding and coiled-coil domain-containing protein 2 (CALCOCO2) ELISA Kit
MBS7232532-04 10x 96 Well

Canine Calcium-binding and coiled-coil domain-containing protein 2 (CALCOCO2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Mutated Citrullinated VImentin Antibody ELISA Kit
MBS040032 Inquire

Rabbit Mutated Citrullinated VImentin Antibody ELISA Kit

Sign In for Pricing
View Details