Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPANXC Peptide - N-terminal region

SPANXC Peptide - N-terminal region

Product Specifications

Product Name Alternative

C, CT11.3, CTp11, SPANX-C

UniProt

Q9NY87

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPANXC Rabbit Polyclonal Antibody (orb584501) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_073152

Preservative

Lyophilized powder

AA Sequence

EVNETMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNVKRTSPEELLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IDE protein (His tag)
PDEH100155-01 20 µg

Recombinant Human IDE protein (His tag)

Sign In for Pricing
View Details
Recombinant Human IDE protein (His tag)
PDEH100155-02 100 µg

Recombinant Human IDE protein (His tag)

Sign In for Pricing
View Details
Flasks, Pear Shaped, Single Neck
2064330/1 1 Each

Flasks, Pear Shaped, Single Neck

Sign In for Pricing
View Details
Tumor Necrosis Factor Receptor 2, Recombinant, Human (TNFR2, CD120b)
MBS650326-01 0.02 mg

Tumor Necrosis Factor Receptor 2, Recombinant, Human (TNFR2, CD120b)

Sign In for Pricing
View Details
Tumor Necrosis Factor Receptor 2, Recombinant, Human (TNFR2, CD120b)
MBS650326-02 5x 0.02 mg

Tumor Necrosis Factor Receptor 2, Recombinant, Human (TNFR2, CD120b)

Sign In for Pricing
View Details
DSC2 ORF Vector (Human) (pORF)
ORF018530 1.0 µg DNA

DSC2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details