Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRGPRX4 Peptide - C-terminal region

MRGPRX4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPCR, MGC129753, MGC129754, MRGX4, SNSR6

UniProt

Q96LA9

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRGPRX4 Rabbit Polyclonal Antibody (orb584512) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_473373

Preservative

Lyophilized powder

AA Sequence

FFVGSFRQRQNRQNLKLVLQRALQDKPEVDKGEGQLPEESLELSGSRLGP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (rOV-TL12/30), CF594 conjugate, 0.1mg/mL
BNC941841-500 1x 500 µL

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (rOV-TL12/30), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Integrin β3 (Ab-773) Antibody
8B7118-AAT 50 µg

Integrin β3 (Ab-773) Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Metastasis, unknown source
CS629905 5x 5 µm

Frozen Tissue Sections, Metastasis, unknown source

Sign In for Pricing
View Details
Human TRA16 (NR2C2AP) activation kit by CRISPRa
GA114943 1 Kit

Human TRA16 (NR2C2AP) activation kit by CRISPRa

Sign In for Pricing
View Details
5-Chloro-2,3-dihydrobenzofuran
TRC-C597755-10MG 10 mg

5-Chloro-2,3-dihydrobenzofuran

Sign In for Pricing
View Details
Dry Bath Incubator BDIB-108
BDIB-108 1 Unit

Dry Bath Incubator BDIB-108

Sign In for Pricing
View Details