F2RL1 Peptide - C-terminal region
F2RL1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
GPR11, PAR2
UniProt
P55085
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with F2RL1 Rabbit Polyclonal Antibody (orb584549) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005233
Preservative
Lyophilized powder
AA Sequence
VSHDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042848-500 1x 500 µL
Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940525-100 1x 100 µL
CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740270-500 1x 500 µL
Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680304-100 1x 100 µL
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470735-100 1x 100 µL
Human Lambda Light Chain (LcN-2 + ICO-106), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400949-100 1x 100 µL
Cytokeratin 7/17 (C-46), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details