Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD99L2 Peptide - middle region

CD99L2 Peptide - middle region

Product Specifications

Product Name Alternative

CD99B, DKFZp761H2024, MIC2L1

UniProt

Q8TCZ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD99L2 Rabbit Polyclonal Antibody (orb584741) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001229543

Preservative

Lyophilized powder

AA Sequence

RDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotinylated Recombinant Human Notch 2 Protein
RP02462B-01 100 μg

Biotinylated Recombinant Human Notch 2 Protein

Sign In for Pricing
View Details
Biotinylated Recombinant Human Notch 2 Protein
RP02462B-02 500 μg

Biotinylated Recombinant Human Notch 2 Protein

Sign In for Pricing
View Details
PARN Rabbit Polyclonal Antibody (AP)
orb961895 100 µL

PARN Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Rat Tox ELISA Kit
MBS3808809-01 48 Well

Rat Tox ELISA Kit

Sign In for Pricing
View Details
Rat Tox ELISA Kit
MBS3808809-02 96 Well

Rat Tox ELISA Kit

Sign In for Pricing
View Details
Rat Tox ELISA Kit
MBS3808809-03 5x 96 Well

Rat Tox ELISA Kit

Sign In for Pricing
View Details