Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSH2D Peptide - C-terminal region

HSH2D Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALX, FLJ14886, HSH2

UniProt

Q96JZ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSH2D Rabbit Polyclonal Antibody (orb331105) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116244

Preservative

Lyophilized powder

AA Sequence

RSVSCIEVTPGDRSWHQMVVRALSSQESKPEHQGLAEPENDQLPEEYQQP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BACE1 (NM_012104) Human Recombinant Protein
TP309115M 100 µg

BACE1 (NM_012104) Human Recombinant Protein

Sign In for Pricing
View Details
HLA Class II DR Mouse Monoclonal Antibody [Clone ID: L243]
AM26708RP-N 100 Tests

HLA Class II DR Mouse Monoclonal Antibody [Clone ID: L243]

Sign In for Pricing
View Details
Diethyl Phosphate Sodium Salt
TRC-D444720-250MG 250 mg

Diethyl Phosphate Sodium Salt

Sign In for Pricing
View Details
Tofogliflozin
TRC-T528750-5MG 5 mg

Tofogliflozin

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS507759 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
CD146 Recombinant Rabbit Monoclonal Antibody [JB42-35]
ET7107-91 100 µL

CD146 Recombinant Rabbit Monoclonal Antibody [JB42-35]

Sign In for Pricing
View Details