Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSH2D Peptide - C-terminal region

HSH2D Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALX, FLJ14886, HSH2

UniProt

Q96JZ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSH2D Rabbit Polyclonal Antibody (orb331105) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116244

Preservative

Lyophilized powder

AA Sequence

RSVSCIEVTPGDRSWHQMVVRALSSQESKPEHQGLAEPENDQLPEEYQQP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Hydroxy-13-cis-retinoic Acid
TRC-H953395-10MG 10 mg

4-Hydroxy-13-cis-retinoic Acid

Sign In for Pricing
View Details
Recombinant Periostin Antibody
RC-4875-01 50 μL

Recombinant Periostin Antibody

Sign In for Pricing
View Details
Recombinant Periostin Antibody
RC-4875-02 100 µL

Recombinant Periostin Antibody

Sign In for Pricing
View Details
Recombinant Periostin Antibody
RC-4875-03 1 mL

Recombinant Periostin Antibody

Sign In for Pricing
View Details
FXYD6 (NM_001164836) Human Recombinant Protein
TP328721 20 µg

FXYD6 (NM_001164836) Human Recombinant Protein

Sign In for Pricing
View Details
SSR2 (NM_003145) Human Over-expression Lysate
LY418868 100 µg

SSR2 (NM_003145) Human Over-expression Lysate

Sign In for Pricing
View Details