CA13 Peptide - N-terminal region
CA13 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CAXIII, FLJ37995, MGC59868
UniProt
Q8N1Q1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CA13 Rabbit Polyclonal Antibody (orb585954) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_940986
Preservative
Lyophilized powder
AA Sequence
HWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HP228621 200 Reactions
C18orf1 (LDLRAD4) Human qPCR Primer Pair (NM_181481)
Sign In for Pricing
View Details ![Human VE Cadherin Recombinant Rabbit Monoclonal Antibody [PSH02-61] - BSA and Azide free (Capture)](https://cdn.genprice.uk/products/992/68dd1c90061270361ea827e2/imageurl/ha721838.webp)
HA721838 100 µL
Human VE Cadherin Recombinant Rabbit Monoclonal Antibody [PSH02-61] - BSA and Azide free (Capture)
Sign In for Pricing
View Details 