Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA13 Peptide - N-terminal region

CA13 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAXIII, FLJ37995, MGC59868

UniProt

Q8N1Q1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CA13 Rabbit Polyclonal Antibody (orb585954) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_940986

Preservative

Lyophilized powder

AA Sequence

HWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIF1 alpha (TRIM24) Rabbit Polyclonal Antibody
AP20510PU-N 100 µg

TIF1 alpha (TRIM24) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
S100B (4C4.9), CF660R conjugate, 0.1mg/mL
BNC610143-500 1x 500 µL

S100B (4C4.9), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRIM22 (NM_006074) Human Over-expression Lysate
LC401829 20 µg

TRIM22 (NM_006074) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS803814 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
Chromogranin A (CHGA/413), CF740 conjugate, 0.1mg/mL
BNC740413-500 1x 500 µL

Chromogranin A (CHGA/413), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Ambp activation kit by CRISPRa
GA200176 1 Kit

Mouse Ambp activation kit by CRISPRa

Sign In for Pricing
View Details