Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAEA Peptide - N-terminal region

MAEA Peptide - N-terminal region

Product Specifications

Product Name Alternative

EMLP, EMP, HLC-10, PIG5

UniProt

Q7L5Y9

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAEA Rabbit Polyclonal Antibody (orb585983) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005873

Preservative

Lyophilized powder

AA Sequence

RFRAAQKNIDRETSHVTMVVAELEKTLSGCPAVDSVVSLLDGVVEKLSVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tumor Protein P53 Regulated Apoptosis Inducing Protein 1 (TP53AIP1) Antibody
abx211060-01 50 µL

Tumor Protein P53 Regulated Apoptosis Inducing Protein 1 (TP53AIP1) Antibody

Sign In for Pricing
View Details
Tumor Protein P53 Regulated Apoptosis Inducing Protein 1 (TP53AIP1) Antibody
abx211060-02 100 µL

Tumor Protein P53 Regulated Apoptosis Inducing Protein 1 (TP53AIP1) Antibody

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-12 protein
CD00345-01 10 µg

Recombinant Mouse Interleukin-12 protein

Sign In for Pricing
View Details
Recombinant Mouse Interleukin-12 protein
CD00345-02 50 µg

Recombinant Mouse Interleukin-12 protein

Sign In for Pricing
View Details
Anti-NADH2/Mtnd2 Antibody Picoband®, iFluor647 Conjugate
A32839-1-iFluor647 100 µg

Anti-NADH2/Mtnd2 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
VN1R16P Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV789351 1.0 µg DNA

VN1R16P Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details