Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STXBP3 Peptide - C-terminal region

STXBP3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MUNC18-3, MUNC18C, PSP, UNC-18C

UniProt

O00186

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STXBP3 Rabbit Polyclonal Antibody (orb585989) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009200

Preservative

Lyophilized powder

AA Sequence

RSAEETFQLSRWTPFIKDIMEDAIDNRLDSKEWPYCSQCPAVWNGSGAVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Miga Antibody
orb806327 2 mg

Miga Antibody

Sign In for Pricing
View Details
ILVBL Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
24923062 1.0 µg DNA

ILVBL Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rabbit Polyclonal FAM46A Antibody
NBP2-99201-100ul 100 µL

Rabbit Polyclonal FAM46A Antibody

Sign In for Pricing
View Details
Nfe2l3 (NM_010903) Mouse Tagged ORF Clone Lentiviral Particle
MR209844L3V 200 µL

Nfe2l3 (NM_010903) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse dopamine decarboxylase, DDC ELISA Kit
CK-bio-16062-01 48 Tests

Mouse dopamine decarboxylase, DDC ELISA Kit

Sign In for Pricing
View Details
Mouse dopamine decarboxylase, DDC ELISA Kit
CK-bio-16062-02 96 Tests

Mouse dopamine decarboxylase, DDC ELISA Kit

Sign In for Pricing
View Details