Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STXBP3 Peptide - C-terminal region

STXBP3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MUNC18-3, MUNC18C, PSP, UNC-18C

UniProt

O00186

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STXBP3 Rabbit Polyclonal Antibody (orb585989) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009200

Preservative

Lyophilized powder

AA Sequence

RSAEETFQLSRWTPFIKDIMEDAIDNRLDSKEWPYCSQCPAVWNGSGAVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

53BP1 (phospho Ser6) Polyclonal Antibody
orb1097140-01 50 μL

53BP1 (phospho Ser6) Polyclonal Antibody

Sign In for Pricing
View Details
53BP1 (phospho Ser6) Polyclonal Antibody
orb1097140-02 100 µL

53BP1 (phospho Ser6) Polyclonal Antibody

Sign In for Pricing
View Details
CAMLG (Calcium Signal-Modulating Cyclophilin Ligand, Calcium Modulating Ligand)
477048 100 µL

CAMLG (Calcium Signal-Modulating Cyclophilin Ligand, Calcium Modulating Ligand)

Sign In for Pricing
View Details
GPM6B Polyclonal Antibody, Cy5 Conjugated
bs-11847R-Cy5-01 20 µL

GPM6B Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
GPM6B Polyclonal Antibody, Cy5 Conjugated
bs-11847R-Cy5-02 100 µL

GPM6B Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Goat Toll Like Receptor 3 (TLR-3) ELISA Kit
MBS266105-01 48 Well

Goat Toll Like Receptor 3 (TLR-3) ELISA Kit

Sign In for Pricing
View Details