Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMGDH Peptide - C-terminal region

DMGDH Peptide - C-terminal region

Product Specifications

Product Name Alternative

DMGDHD, ME2GLYDH

UniProt

Q9UI17

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DMGDH Rabbit Polyclonal Antibody (orb586012) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037523

Preservative

Lyophilized powder

AA Sequence

YVPVQLSEVGQQVEVELLGKNYPAVIIQEPLVLTEPTRNRLQKKGGKDKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGAG1 discontinued
541730-01 30ul

RGAG1 discontinued

Sign In for Pricing
View Details
RGAG1 discontinued
541730-02 100 µL

RGAG1 discontinued

Sign In for Pricing
View Details
Olr1730 (NM_001000279) Rat Tagged Lenti ORF Clone
RR209742L3 10 µg

Olr1730 (NM_001000279) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
POLR1B Rabbit Polyclonal Antibody
orb411900-01 30 µL

POLR1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
POLR1B Rabbit Polyclonal Antibody
orb411900-02 50 μL

POLR1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
POLR1B Rabbit Polyclonal Antibody
orb411900-03 100 µL

POLR1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details