Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL26 Peptide - N-terminal region

IL26 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AK155, IL-26

UniProt

Q9NPH9

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL26 Rabbit Polyclonal Antibody (orb586073) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060872

Preservative

Lyophilized powder

AA Sequence

LVTLSLAIAKHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATIPEDRIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lactal Hexaacetate
TRC-L112500-1G 1 g

Lactal Hexaacetate

Sign In for Pricing
View Details
Human SLC35B3 activation kit by CRISPRa
GA109485 1 Kit

Human SLC35B3 activation kit by CRISPRa

Sign In for Pricing
View Details
BRG1 Recombinant Mouse monoclonal Antibody
HA610205 100 µg

BRG1 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
MDM2 (SMP14), CF405S conjugate, 0.1mg/mL
BNC041721-500 1x 500 µL

MDM2 (SMP14), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Aminoacylase 1 (ACY1) activation kit by CRISPRa
GA100061 1 Kit

Human Aminoacylase 1 (ACY1) activation kit by CRISPRa

Sign In for Pricing
View Details
IL18BP Human
OM296446-01 20 µg

IL18BP Human

Sign In for Pricing
View Details