Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYNPO2 Peptide - C-terminal region

SYNPO2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp686G051

UniProt

Q9UMS6

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SYNPO2 Rabbit Polyclonal Antibody (orb586078) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001122405

Preservative

Lyophilized powder

AA Sequence

FTFKEPKVSPNPELLSLLQNSEGKRGTGAGGDSGPEEDYLSLGAEACNFM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 18 (C-04), CF647 conjugate, 0.1mg/mL
BNC470041-500 1x 500 µL

Cytokeratin 18 (C-04), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APAF1 Rabbit Polyclonal Antibody
R1312-20 100 µL

APAF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RBM23 (NM_001077351) Human Over-expression Lysate
LY421400 100 µg

RBM23 (NM_001077351) Human Over-expression Lysate

Sign In for Pricing
View Details
b-Nicotinamide Adenine Dinucleotide Sodium Salt Hydrate
TRC-N407775-1G 1 g

b-Nicotinamide Adenine Dinucleotide Sodium Salt Hydrate

Sign In for Pricing
View Details
PKC nu (PRKD3) (NM_005813) Human Recombinant Protein
TP762053 50 µg

PKC nu (PRKD3) (NM_005813) Human Recombinant Protein

Sign In for Pricing
View Details
PA2G4 Polyclonal Antibody
E-AB-19268-01 20 µL

PA2G4 Polyclonal Antibody

Sign In for Pricing
View Details