Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PACS1 Peptide - C-terminal region

PACS1 Peptide - C-terminal region

Product Specifications

UniProt

Q6VY07

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PACS1 Rabbit Polyclonal Antibody (orb586082) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

AAH55288

Preservative

Lyophilized powder

AA Sequence

ALAIVGSPNSPYGDVIGLQVDYWLGHPGERRREGDKRDASSKNTLKSVFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse CXCL9 (MIG-2F5-5) In Vivo Antibody - Low Endotoxin
ICH1204-25mg 25 mg

Anti-Mouse CXCL9 (MIG-2F5-5) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Atosiban Acetate
TRC-A791890-25MG 25 mg

Atosiban Acetate

Sign In for Pricing
View Details
Parathyroid Hormone (PTH) (N-Terminal) (rPTH/911), CF647 conjugate, 0.1mg/mL
BNC471899-100 1x 100 µL

Parathyroid Hormone (PTH) (N-Terminal) (rPTH/911), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rassf8 Mouse Gene Knockout Kit (CRISPR)
KN514522 1 Kit

Rassf8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
S100A4 (Marker of Tumor Metastasis) (S100A4/2750R), Biotin conjugate, 0.1mg/mL
BNCB2750-100 1x 100 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/2750R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ERAP1 Recombinant Rabbit Monoclonal Antibody [JE52-36]
ET7110-29 100 µL

ERAP1 Recombinant Rabbit Monoclonal Antibody [JE52-36]

Sign In for Pricing
View Details