Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PACS1 Peptide - C-terminal region

PACS1 Peptide - C-terminal region

Product Specifications

UniProt

Q6VY07

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PACS1 Rabbit Polyclonal Antibody (orb586082) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

AAH55288

Preservative

Lyophilized powder

AA Sequence

ALAIVGSPNSPYGDVIGLQVDYWLGHPGERRREGDKRDASSKNTLKSVFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARVCF (NM_001670) Human Over-expression Lysate
LY419792 100 µg

ARVCF (NM_001670) Human Over-expression Lysate

Sign In for Pricing
View Details
MC3R Rabbit Polyclonal Antibody
TA361222 100 µL

MC3R Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human SOS1 activation kit by CRISPRa
GA104564 1 Kit

Human SOS1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Coiled Coil Domain Containing Protein 80 (CCDC80) ELISA Kit
RD-CCDC80-Hu-01 96 Tests

Human Coiled Coil Domain Containing Protein 80 (CCDC80) ELISA Kit

Sign In for Pricing
View Details
Human Coiled Coil Domain Containing Protein 80 (CCDC80) ELISA Kit
RD-CCDC80-Hu-02 48 Tests

Human Coiled Coil Domain Containing Protein 80 (CCDC80) ELISA Kit

Sign In for Pricing
View Details
N-Pivaloylglycine
TRC-P550740-50MG 50 mg

N-Pivaloylglycine

Sign In for Pricing
View Details