Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKP4 Peptide - N-terminal region

PKP4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ31261, FLJ42243, p0071

UniProt

Q99569

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PKP4 Rabbit Polyclonal Antibody (orb586083) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005476

Preservative

Lyophilized powder

AA Sequence

MPAPEQASLVEEGQPQTRQEAASTGPGMEPETTATTILASVKEQELQFQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS503840 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD106 Antibody
RD21047F-01 25 µg

PerCP/Cyanine5.5 Anti-Mouse CD106 Antibody

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD106 Antibody
RD21047F-02 100 µg

PerCP/Cyanine5.5 Anti-Mouse CD106 Antibody

Sign In for Pricing
View Details
CBL Mouse Monoclonal Antibody [Clone ID: 3B12]
AM06661SU-N 100 µL

CBL Mouse Monoclonal Antibody [Clone ID: 3B12]

Sign In for Pricing
View Details
Vmac (NM_178926) Mouse Tagged ORF Clone
MG201501 10 µg

Vmac (NM_178926) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Cap1 Mouse Gene Knockout Kit (CRISPR)
KN502499 1 Kit

Cap1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details