Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKP4 Peptide - N-terminal region

PKP4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ31261, FLJ42243, p0071

UniProt

Q99569

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PKP4 Rabbit Polyclonal Antibody (orb586083) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005476

Preservative

Lyophilized powder

AA Sequence

MPAPEQASLVEEGQPQTRQEAASTGPGMEPETTATTILASVKEQELQFQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CBX8 activation kit by CRISPRa
GA111465 1 Kit

Human CBX8 activation kit by CRISPRa

Sign In for Pricing
View Details
CAB39L (NM_001079670) Human Recombinant Protein
TP311881M 100 µg

CAB39L (NM_001079670) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS708607 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Mouse Clcn5 activation kit by CRISPRa
GA200748 1 Kit

Mouse Clcn5 activation kit by CRISPRa

Sign In for Pricing
View Details
Human Lymphotoxin Beta Receptor (LTbR) ELISA Kit
RDR-LTbR-Hu-01 96 Tests

Human Lymphotoxin Beta Receptor (LTbR) ELISA Kit

Sign In for Pricing
View Details
Human Lymphotoxin Beta Receptor (LTbR) ELISA Kit
RDR-LTbR-Hu-02 48 Tests

Human Lymphotoxin Beta Receptor (LTbR) ELISA Kit

Sign In for Pricing
View Details