Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBFA Peptide - C-terminal region

RBFA Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ18281, FLJ18505, FLJ21172, FLJ42604, FLJ97160, HsT169

UniProt

Q8N0V3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RBFA Rabbit Polyclonal Antibody (orb586085) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079081

Preservative

Lyophilized powder

AA Sequence

KGLGGLVWQGQVAELTTQMKKGRKRAKPRLEQDSSLKSYLSGEEVEDDLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC26A6 CytoSection
TS414193P5 25 Slides

SLC26A6 CytoSection

Sign In for Pricing
View Details
Lentiviral mouse Clec18a shRNA (UAS) - Lentiviral mouse Clec18a shRNA (UAS) (25)
GTR15290753 1 Vial

Lentiviral mouse Clec18a shRNA (UAS) - Lentiviral mouse Clec18a shRNA (UAS) (25)

Sign In for Pricing
View Details
FUT4 Antibody (C-term)
MBS9203473-01 0.08 mL

FUT4 Antibody (C-term)

Sign In for Pricing
View Details
FUT4 Antibody (C-term)
MBS9203473-02 0.4 mL

FUT4 Antibody (C-term)

Sign In for Pricing
View Details
FUT4 Antibody (C-term)
MBS9203473-03 5x 0.4 mL

FUT4 Antibody (C-term)

Sign In for Pricing
View Details
Mouse Monoclonal EZH2/KMT6 Antibody (EZH2/6988) [Janelia Fluor 646]
NBP3-20982JF646 0.1 mL

Mouse Monoclonal EZH2/KMT6 Antibody (EZH2/6988) [Janelia Fluor 646]

Sign In for Pricing
View Details