CD96 Peptide - C-terminal region
CD96 Peptide - C-terminal region
Product Specifications
Product Name Alternative
DKFZp667E2122, MGC22596, TACTILE
UniProt
P40200
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CD96 Rabbit Polyclonal Antibody (orb586087) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_937839
Preservative
Lyophilized powder
AA Sequence
TTPQPSNSSMTTRGFNYPWTSSGTDTKKSVSRIPSETYSSSPSGAGSTLH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15161824 1 Vial
Lentiviral human GAPDH shRNA (UAS) - Lentiviral human GAPDH shRNA (UAS, iRFP) plasmid
Sign In for Pricing
View Details 
LVP954-N-PBS 1x 10^8 IFU/mL - 200 μL
AP1-RFP (Neo) Lentivirus in PBS
Sign In for Pricing
View Details 
MBS1391218-01 0.02 mg (E-Coli)
Recombinant Xenopus laevis N-alpha-acetyltransferase 40 (naa40)
Sign In for Pricing
View Details MBS1391218-02 0.1 mg (E-Coli)
Recombinant Xenopus laevis N-alpha-acetyltransferase 40 (naa40)
Sign In for Pricing
View Details