Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC7 Peptide - C-terminal region

LRRC7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DENSIN

UniProt

Q96NW7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC7 Rabbit Polyclonal Antibody (orb326516) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

BAA92603

Preservative

Lyophilized powder

AA Sequence

YNLGNYGDKPSDNSDLKTRPTPVKGEESCGKMPADWRQQLLRHIEARRLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGEF1 Antibody
KC-2356-01 50 μL

ARHGEF1 Antibody

Sign In for Pricing
View Details
ARHGEF1 Antibody
KC-2356-02 100 µL

ARHGEF1 Antibody

Sign In for Pricing
View Details
ARHGEF1 Antibody
KC-2356-03 1 mL

ARHGEF1 Antibody

Sign In for Pricing
View Details
CD1E (NM_001185114) Human Over-expression Lysate
LY434131 100 µg

CD1E (NM_001185114) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS708762 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
Glucose 6-Phosphate Isomerase (CPTC-GPI-1), 0.2mg/mL
BNUB2257-100 1x 100 µL

Glucose 6-Phosphate Isomerase (CPTC-GPI-1), 0.2mg/mL

Sign In for Pricing
View Details