Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC7 Peptide - C-terminal region

LRRC7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DENSIN

UniProt

Q96NW7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC7 Rabbit Polyclonal Antibody (orb326516) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

BAA92603

Preservative

Lyophilized powder

AA Sequence

YNLGNYGDKPSDNSDLKTRPTPVKGEESCGKMPADWRQQLLRHIEARRLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wdr44 Mouse Gene Knockout Kit (CRISPR)
KN519360 1 Kit

Wdr44 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AIF1 / Iba1 (Microglia Marker) (rAIF1/1909), CF488A conjugate, 0.1mg/mL
BNC882346-500 1x 500 µL

AIF1 / Iba1 (Microglia Marker) (rAIF1/1909), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2423), CF568 conjugate, 0.1mg/mL
BNC682423-500 1x 500 µL

BOB.1 (B-Cell Marker) (BOB1/2423), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 Mouse Monoclonal Antibody [1-80]
EM00704 100 µL

HSP60 Mouse Monoclonal Antibody [1-80]

Sign In for Pricing
View Details
Muscle Specific Actin (HHF35), 0.2mg/mL
BNUB0445-100 1x 100 µL

Muscle Specific Actin (HHF35), 0.2mg/mL

Sign In for Pricing
View Details
METTL27 Rabbit Polyclonal Antibody
TA383295 100 µL

METTL27 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details