Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LTV1 Peptide - C-terminal region

LTV1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C6orf93, FLJ14909, FLJ18519, dJ468K18.4

UniProt

Q96GA3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LTV1 Rabbit Polyclonal Antibody (orb586100) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116249

Preservative

Lyophilized powder

AA Sequence

DLPKVSTQPRSKNESKEDKRARKQAIKEERKERRVEKKANKLAFKLEKRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), CF594 conjugate, 0.1mg/mL
BNC942168-100 1x 100 µL

Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Trk B Monoclonal Antibody
E-AB-81617-01 50 µL

Recombinant Trk B Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Trk B Monoclonal Antibody
E-AB-81617-02 100 µL

Recombinant Trk B Monoclonal Antibody

Sign In for Pricing
View Details
ENAH / MENA (Actin Regulator) (ENAH/1988), CF640R conjugate, 0.1mg/mL
BNC401988-100 1x 100 µL

ENAH / MENA (Actin Regulator) (ENAH/1988), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ELAVL3 Antibody
OC-1793-01 50 μL

ELAVL3 Antibody

Sign In for Pricing
View Details
ELAVL3 Antibody
OC-1793-02 100 µL

ELAVL3 Antibody

Sign In for Pricing
View Details