Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LTV1 Peptide - C-terminal region

LTV1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C6orf93, FLJ14909, FLJ18519, dJ468K18.4

UniProt

Q96GA3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LTV1 Rabbit Polyclonal Antibody (orb586100) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116249

Preservative

Lyophilized powder

AA Sequence

DLPKVSTQPRSKNESKEDKRARKQAIKEERKERRVEKKANKLAFKLEKRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD74 Antibody Pair Set
E-KAB-0510 50 µL & 100 µg

Human CD74 Antibody Pair Set

Sign In for Pricing
View Details
Histone H4 (acetyl K8) Recombinant Rabbit Monoclonal Antibody [PS01-25]
HA721249 100 µL

Histone H4 (acetyl K8) Recombinant Rabbit Monoclonal Antibody [PS01-25]

Sign In for Pricing
View Details
METTL2A (NM_001005372) Human Over-expression Lysate
LC423705 20 µg

METTL2A (NM_001005372) Human Over-expression Lysate

Sign In for Pricing
View Details
SDF1 (CXCL12) (NM_000609) Human Recombinant Protein
TP720103L 500 µg

SDF1 (CXCL12) (NM_000609) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS621123 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
JAK2 Rabbit Polyclonal Antibody
AP08094PU-S 50 µL

JAK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details