Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG13 Peptide - N-terminal region

ALG13 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RP1-298J18.2, CXorf45, GLT28D1, MDS031, YGL047W

UniProt

Q9NP73

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALG13 Rabbit Polyclonal Antibody (orb325424) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060936

Preservative

Lyophilized powder

AA Sequence

CVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-3BP2/SH3BP2 Antibody Picoband®, HRP Conjugate
A04008-1-HRP 100 µg/Vial

Anti-3BP2/SH3BP2 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
Heat shock factor protein 1
AP83764-01 50 µg

Heat shock factor protein 1

Sign In for Pricing
View Details
Heat shock factor protein 1
AP83764-02 100 µg

Heat shock factor protein 1

Sign In for Pricing
View Details
Heat shock factor protein 1
AP83764-03 1 mg

Heat shock factor protein 1

Sign In for Pricing
View Details
NAIF1 Polyclonal Antibody, HRP Conjugated
bs-0452R-HRP 100 µL

NAIF1 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Bovine Luteinizing Hormone (LH) ELISA Kit
DLR-LH-b-01 48 Tests

Bovine Luteinizing Hormone (LH) ELISA Kit

Sign In for Pricing
View Details