Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG13 Peptide - N-terminal region

ALG13 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RP1-298J18.2, CXorf45, GLT28D1, MDS031, YGL047W

UniProt

Q9NP73

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALG13 Rabbit Polyclonal Antibody (orb325424) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060936

Preservative

Lyophilized powder

AA Sequence

CVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

dye Antibody, Biotin conjugated
A59666-50UG 50 µg

dye Antibody, Biotin conjugated

Sign In for Pricing
View Details
3- (4-chlorophenyl) -7-hydroxy-2H-chromen-2-one
sc-345603 1 g

3- (4-chlorophenyl) -7-hydroxy-2H-chromen-2-one

Sign In for Pricing
View Details
Nezutatug Biosimilar - Research Grade
ICH5710-25mg 25 mg

Nezutatug Biosimilar - Research Grade

Sign In for Pricing
View Details
Rat RPE65 siRNA
abx931884-01 15 nmol

Rat RPE65 siRNA

Sign In for Pricing
View Details
Rat RPE65 siRNA
abx931884-02 30 nmol

Rat RPE65 siRNA

Sign In for Pricing
View Details
SEC31A Recombinant Protein Antigen
NBP1-89301PEP 0.1 mL

SEC31A Recombinant Protein Antigen

Sign In for Pricing
View Details