Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJB7 Peptide - C-terminal region

DNAJB7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DJ5, HSC3, MGC138340

UniProt

Q7Z6W7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAJB7 Rabbit Polyclonal Antibody (orb581841) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660157

Preservative

Lyophilized powder

AA Sequence

AEDNGELTFFLVNSVANEEGFAKECSWRTQSFNNYSPNSHSSKHVSQYTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

384 Clear Wells Blue Frame
PCR0422 10 / PCK

384 Clear Wells Blue Frame

Sign In for Pricing
View Details
ATG13 Rabbit pAb, PerCP-Cy7 conjugated
orb2842197 100 µL

ATG13 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Albumin (ALB)
MBS2050722-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Albumin (ALB)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Albumin (ALB)
MBS2050722-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Albumin (ALB)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Albumin (ALB)
MBS2050722-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Albumin (ALB)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Albumin (ALB)
MBS2050722-04 1 mL

Cy3-Linked Polyclonal Antibody to Albumin (ALB)

Sign In for Pricing
View Details