DNAJB7 Peptide - C-terminal region
DNAJB7 Peptide - C-terminal region
Product Specifications
Product Name Alternative
DJ5, HSC3, MGC138340
UniProt
Q7Z6W7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DNAJB7 Rabbit Polyclonal Antibody (orb581841) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_660157
Preservative
Lyophilized powder
AA Sequence
AEDNGELTFFLVNSVANEEGFAKECSWRTQSFNNYSPNSHSSKHVSQYTF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
408006-01 1 mg
1- (4-Bromobutyl) -3,4-dihydro-7-hydroxy-2 (1H) -quinolinone 7-Benzyl Ester
Sign In for Pricing
View Details 408006-02 5 mg
1- (4-Bromobutyl) -3,4-dihydro-7-hydroxy-2 (1H) -quinolinone 7-Benzyl Ester
Sign In for Pricing
View Details 
orb952968 100 µL
Phospho-IKB alpha (Ser32) Rabbit Polyclonal Antibody (Cy5)
Sign In for Pricing
View Details 
MBS6011705-01 1 mL
FUCA (alpha-L-Fucosidase, a-L-Fucosidase) (Biotin)
Sign In for Pricing
View Details