Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPN3 Peptide - C-terminal region

CAPN3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CANP3, CANPL3, LGMD2, LGMD2A, MGC10767, MGC11121, MGC14344, MGC4403, nCL-1, p94

UniProt

P20807

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPN3 Rabbit Polyclonal Antibody (orb584849) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077320

Preservative

Lyophilized powder

AA Sequence

DRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAB2 Antibody
orb1289331 100 µL

GAB2 Antibody

Sign In for Pricing
View Details
Porcine Alpha-Fetoprotein Lens Culinaris Agglutinin 2 (AFP-L2) ELISA Kit
NSL1469Po 96 Tests

Porcine Alpha-Fetoprotein Lens Culinaris Agglutinin 2 (AFP-L2) ELISA Kit

Sign In for Pricing
View Details
Mouse Kcnab3 Pre-designed siRNA Set B
SI107011B 1 Each

Mouse Kcnab3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Nori® Rat BMP2 ELISA Kit
GR118130 96 Well

Nori® Rat BMP2 ELISA Kit

Sign In for Pricing
View Details
ZNF496 (Zinc Finger Protein 496, MGC15548, NIZP1, ZKSCAN17) (MaxLight 750) discontinued
253804-ML750 100 µL

ZNF496 (Zinc Finger Protein 496, MGC15548, NIZP1, ZKSCAN17) (MaxLight 750) discontinued

Sign In for Pricing
View Details
CCL7 Protein Vector (Rat) (pPB-C-His)
PV258238 500 ng

CCL7 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details