Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPN3 Peptide - C-terminal region

CAPN3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CANP3, CANPL3, LGMD2, LGMD2A, MGC10767, MGC11121, MGC14344, MGC4403, nCL-1, p94

UniProt

P20807

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPN3 Rabbit Polyclonal Antibody (orb584849) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077320

Preservative

Lyophilized powder

AA Sequence

DRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNGase siRNA (h)
sc-78460 10 µM

PNGase siRNA (h)

Sign In for Pricing
View Details
CKAP2 Rabbit pAb, PerCP-Cy7 conjugated
orb2857939 100 µL

CKAP2 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
COX6A1 Antibody - C-terminal region
MBS3222681-01 0.1 mL

COX6A1 Antibody - C-terminal region

Sign In for Pricing
View Details
COX6A1 Antibody - C-terminal region
MBS3222681-02 5x 0.1 mL

COX6A1 Antibody - C-terminal region

Sign In for Pricing
View Details
MIB2 (NM_001170686) Human Over-expression Lysate
LY433639 100 µg

MIB2 (NM_001170686) Human Over-expression Lysate

Sign In for Pricing
View Details
C15orf15 (RSL24D1) Human Over-expression Lysate
orb1369175 20 µg

C15orf15 (RSL24D1) Human Over-expression Lysate

Sign In for Pricing
View Details