Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HYI Peptide - N-terminal region

HYI Peptide - N-terminal region

Product Specifications

Product Name Alternative

HT036, MGC20767

UniProt

Q5T013

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HYI Rabbit Polyclonal Antibody (orb585974) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112484

Preservative

Lyophilized powder

AA Sequence

AGLRLVLINTPPGDQEKGEMGLGAVPGRQAAFREGLEQAVRYAKALGCPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HIF-1 alpha / HIF1A Protein (His tag)
MBS2545615-01 0.1 mg

Recombinant Human HIF-1 alpha / HIF1A Protein (His tag)

Sign In for Pricing
View Details
Recombinant Human HIF-1 alpha / HIF1A Protein (His tag)
MBS2545615-02 5x 0.1 mg

Recombinant Human HIF-1 alpha / HIF1A Protein (His tag)

Sign In for Pricing
View Details
CD56 Polyclonal Antibody
UB-GEN-13879 100 µL

CD56 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit XAB2 Antibody
orb1524467-01 10 µL

Rabbit XAB2 Antibody

Sign In for Pricing
View Details
Rabbit XAB2 Antibody
orb1524467-02 100 µL

Rabbit XAB2 Antibody

Sign In for Pricing
View Details
Troponin I antibody (Cardiac)
10-T79J 1 mg

Troponin I antibody (Cardiac)

Sign In for Pricing
View Details