AKR1A1 Peptide - N-terminal region
AKR1A1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ALDR1, ALR, ARM, DD3, MGC12529, MGC1380
UniProt
P14550
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AKR1A1 Rabbit Polyclonal Antibody (orb331284) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006057
Preservative
Lyophilized powder
AA Sequence
YGNEPEIGEALKEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680679-500 1x 500 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940177-500 1x 500 µL
CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940525-100 1x 100 µL
CD63 (MX-49.129.5), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940009-500 1x 500 µL
MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details