Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAPSA Peptide - C-terminal region

NAPSA Peptide - C-terminal region

Product Specifications

Product Name Alternative

KAP, Kdap, NAP1, NAPA, SNAPA

UniProt

O96009

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NAPSA Rabbit Polyclonal Antibody (orb585995) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004842

Preservative

Lyophilized powder

AA Sequence

PAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICAM3 (NM_002162) Human Tagged Lenti ORF Clone
RC208919L1 10 µg

ICAM3 (NM_002162) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Silicon (IV) oxide, 99.99%, -100 mesh
GX8518-50g 50 g

Silicon (IV) oxide, 99.99%, -100 mesh

Sign In for Pricing
View Details
ATG10 Polyclonal Antibody, HRP Conjugated
A67183-050 50 µL

ATG10 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Enc1 shRNA (UAS) - Lentiviral mouse Enc1 shRNA (UAS, iRFP) (100)
GTR15300570 1 Vial

Lentiviral mouse Enc1 shRNA (UAS) - Lentiviral mouse Enc1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Naip2 3'UTR GFP Stable Cell Line
TU263725 1.0 mL

Naip2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
GOLGA6L9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
22386111 3x 1.0 µg

GOLGA6L9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details