Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP17 Peptide - C-terminal region

MMP17 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MT4-MMP

UniProt

Q9ULZ9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MMP17 Rabbit Polyclonal Antibody (orb586006) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057239

Preservative

Lyophilized powder

AA Sequence

YPQSTARDWLVCGDSQADGSVAAGVDAAEGPRAPPGQHDQSRSEDGYEVC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYSLTR2 (Cysteinyl Leukotriene Receptor 2) BioAssayTM ELISA Kit (Mouse) discontinued
382614 96 Tests

CYSLTR2 (Cysteinyl Leukotriene Receptor 2) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
Mouse Surfactant Associated Protein D (SPD) ELISA
EIA06365m 1 Kit

Mouse Surfactant Associated Protein D (SPD) ELISA

Sign In for Pricing
View Details
Zebrafish NKX2.4A/NKX2 Rabbit Polyclonal Antibody (HRP)
orb3003841 100 µg

Zebrafish NKX2.4A/NKX2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
MRM3 Human Pre-designed siRNA Set A
HY-RS08657 1 Set

MRM3 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
AtPep3
HY-P2194 1 Each

AtPep3

Sign In for Pricing
View Details
C12orf24 293 Cell Lysate
401969 0.1 mg

C12orf24 293 Cell Lysate

Sign In for Pricing
View Details