Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP17 Peptide - C-terminal region

MMP17 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MT4-MMP

UniProt

Q9ULZ9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MMP17 Rabbit Polyclonal Antibody (orb586006) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057239

Preservative

Lyophilized powder

AA Sequence

YPQSTARDWLVCGDSQADGSVAAGVDAAEGPRAPPGQHDQSRSEDGYEVC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OOCA01223-25T - Human ORM1 Primer Pair
OOCA01223-25T 25 Tests

OOCA01223-25T - Human ORM1 Primer Pair

Sign In for Pricing
View Details
RAI17, CT (Zinc Finger MIZ Domain-containing Protein 1, Retinoic Acid-induced Protein 17, PIAS-like Protein Zimp10, ZMIZ1, KIAA1224, ZIMP10) (MaxLight 405)
MBS6497426-01 0.1 mL

RAI17, CT (Zinc Finger MIZ Domain-containing Protein 1, Retinoic Acid-induced Protein 17, PIAS-like Protein Zimp10, ZMIZ1, KIAA1224, ZIMP10) (MaxLight 405)

Sign In for Pricing
View Details
RAI17, CT (Zinc Finger MIZ Domain-containing Protein 1, Retinoic Acid-induced Protein 17, PIAS-like Protein Zimp10, ZMIZ1, KIAA1224, ZIMP10) (MaxLight 405)
MBS6497426-02 5x 0.1 mL

RAI17, CT (Zinc Finger MIZ Domain-containing Protein 1, Retinoic Acid-induced Protein 17, PIAS-like Protein Zimp10, ZMIZ1, KIAA1224, ZIMP10) (MaxLight 405)

Sign In for Pricing
View Details
Microsomal Glutathione S-transferase 1/MGST1 Rabbit Polyclonal Antibody (Biotin)
orb2619607 100 µg

Microsomal Glutathione S-transferase 1/MGST1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Phospho-SLP-76 (Ser376) (E3G9U) XP® Rabbit Monoclonal Antibody (PE-Cy7® Conjugate)
CST 94697S 100 µL

Phospho-SLP-76 (Ser376) (E3G9U) XP® Rabbit Monoclonal Antibody (PE-Cy7® Conjugate)

Sign In for Pricing
View Details
TDRD7 siRNA (Human)
orb1859997-01 15 nmol

TDRD7 siRNA (Human)

Sign In for Pricing
View Details