Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL4 Peptide - N-terminal region

RPL4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

L4

UniProt

Q5RCR3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL4 Rabbit Polyclonal Antibody (orb326503) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000959

Preservative

Lyophilized powder

AA Sequence

ICSALAASALPALVMSKGHRIEEVPELPLVVEDKVEGYKKTKEAVLLLKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amperozide HCl
MBS5773500-01 10 mg

Amperozide HCl

Sign In for Pricing
View Details
Amperozide HCl
MBS5773500-02 5 mg

Amperozide HCl

Sign In for Pricing
View Details
Amperozide HCl
MBS5773500-03 50 mg

Amperozide HCl

Sign In for Pricing
View Details
Amperozide HCl
MBS5773500-04 5x 5 mg

Amperozide HCl

Sign In for Pricing
View Details
Amperozide HCl
MBS5773500-05 5x 50 mg

Amperozide HCl

Sign In for Pricing
View Details
Catenin δ-1 (Phospho Ser320) Antibody
A9401-01 50 μL

Catenin δ-1 (Phospho Ser320) Antibody

Sign In for Pricing
View Details