Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL4 Peptide - N-terminal region

RPL4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

L4

UniProt

Q5RCR3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL4 Rabbit Polyclonal Antibody (orb326503) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000959

Preservative

Lyophilized powder

AA Sequence

ICSALAASALPALVMSKGHRIEEVPELPLVVEDKVEGYKKTKEAVLLLKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP28 (NM_001032278) Human Untagged Clone
SC302618 10 µg

MMP28 (NM_001032278) Human Untagged Clone

Sign In for Pricing
View Details
Coumachlor
461170 1.0g

Coumachlor

Sign In for Pricing
View Details
MAGEB6 293 Cell Lysate
403920 0.1 mg

MAGEB6 293 Cell Lysate

Sign In for Pricing
View Details
PLSCR3 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-7099R-BF647 100 µL

PLSCR3 Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
PD169316 (p38 MAPK inhibitor)
SD5946-5mg 5 mg

PD169316 (p38 MAPK inhibitor)

Sign In for Pricing
View Details
SGK3 (C-6) HRP
sc-166847 HRP 200 µg/mL

SGK3 (C-6) HRP

Sign In for Pricing
View Details