Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IDO1 Peptide - C-terminal region

IDO1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IDO, INDO, IDO-1

UniProt

P14902

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IDO1 Rabbit Polyclonal Antibody (orb586034) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002155

Preservative

Lyophilized powder

AA Sequence

ILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLKTVRSTTEKSLLKEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDFY3 Antibody: Biotin
SPC-666D-BI 100 µg

WDFY3 Antibody: Biotin

Sign In for Pricing
View Details
Optitrol NAT HIV-2
NT01035 5x 1.2 mL

Optitrol NAT HIV-2

Sign In for Pricing
View Details
VCX2 (NM_016378) Human Recombinant Protein
TP313997M 100 µg

VCX2 (NM_016378) Human Recombinant Protein

Sign In for Pricing
View Details
Vitamin B12-O5'-NHS Ester
TRC-V675670-2.5MG 2.5 mg

Vitamin B12-O5'-NHS Ester

Sign In for Pricing
View Details
Human ZCCHC17 activation kit by CRISPRa
GA109862 1 Kit

Human ZCCHC17 activation kit by CRISPRa

Sign In for Pricing
View Details
Potassium Isobutyrate
TRC-P993420-250MG 250 mg

Potassium Isobutyrate

Sign In for Pricing
View Details