Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IDO1 Peptide - C-terminal region

IDO1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IDO, INDO, IDO-1

UniProt

P14902

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IDO1 Rabbit Polyclonal Antibody (orb586034) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002155

Preservative

Lyophilized powder

AA Sequence

ILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLKTVRSTTEKSLLKEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse F12 (Coagulation Factor XII) CLIA Kit
E-CL-M0209-01 24 Tests

Mouse F12 (Coagulation Factor XII) CLIA Kit

Sign In for Pricing
View Details
Mouse F12 (Coagulation Factor XII) CLIA Kit
E-CL-M0209-02 48 Tests

Mouse F12 (Coagulation Factor XII) CLIA Kit

Sign In for Pricing
View Details
Mouse F12 (Coagulation Factor XII) CLIA Kit
E-CL-M0209-03 96 Tests

Mouse F12 (Coagulation Factor XII) CLIA Kit

Sign In for Pricing
View Details
Sodium Metasilicate
TRC-S224405-5G 5 g

Sodium Metasilicate

Sign In for Pricing
View Details
NUDT12 (NM_031438) Human Recombinant Protein
TP307724M 100 µg

NUDT12 (NM_031438) Human Recombinant Protein

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD90 Antibody[5E10]
E-AB-F1167J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD90 Antibody[5E10]

Sign In for Pricing
View Details