Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUCLA2 Peptide - N-terminal region

SUCLA2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

A-BETA, SCS-betaA, MTDPS5

UniProt

Q9P2R7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SUCLA2 Rabbit Polyclonal Antibody (orb331292) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003841

Preservative

Lyophilized powder

AA Sequence

LKGGVKIVFSPEEAKAVSSQMIGKKLFTKQTGEKGRICNQVLVCERKYPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VLDL Receptor (VLDLR) Human Gene Knockout Kit (CRISPR)
KN211796LP 1 Kit

VLDL Receptor (VLDLR) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ASCC1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G5]
TA503721AM 100 µL

ASCC1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G5]

Sign In for Pricing
View Details
LIN7 (LIN7B) Goat Polyclonal Antibody
AP31418PU-N 100 µg

LIN7 (LIN7B) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3244), 0.2mg/mL
BNUB3244-100 1x 100 µL

Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3244), 0.2mg/mL

Sign In for Pricing
View Details
1-Benzyl-4-phenyl-4-piperidinecarboxylic Acid Hydrochloride
TRC-B288675-100MG 100 mg

1-Benzyl-4-phenyl-4-piperidinecarboxylic Acid Hydrochloride

Sign In for Pricing
View Details
Glyceryl Tripalmitelaidate
TRC-G601555-500MG 500 mg

Glyceryl Tripalmitelaidate

Sign In for Pricing
View Details