Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUCLA2 Peptide - N-terminal region

SUCLA2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

A-BETA, SCS-betaA, MTDPS5

UniProt

Q9P2R7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SUCLA2 Rabbit Polyclonal Antibody (orb331292) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003841

Preservative

Lyophilized powder

AA Sequence

LKGGVKIVFSPEEAKAVSSQMIGKKLFTKQTGEKGRICNQVLVCERKYPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 700 Anti-Human CD73 Antibody[AD2]
E-AB-F1242M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD73 Antibody[AD2]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD73 Antibody[AD2]
E-AB-F1242M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD73 Antibody[AD2]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD73 Antibody[AD2]
E-AB-F1242M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD73 Antibody[AD2]

Sign In for Pricing
View Details
APC Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034E-01 50 Tests

APC Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details
APC Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034E-02 100 Tests

APC Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details
APC Anti-Mouse CD162 Antibody[4RA10]
E-AB-F1034E-03 2x 100 Tests

APC Anti-Mouse CD162 Antibody[4RA10]

Sign In for Pricing
View Details