CILP Peptide - C-terminal region
CILP Peptide - C-terminal region
Product Specifications
Product Name Alternative
CILP-1, HsT18872
UniProt
O75339
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CILP Rabbit Polyclonal Antibody (orb331293) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003604
Preservative
Lyophilized powder
AA Sequence
YIKVKIVGPLEVNVRSRNMGGTHRQTVGKLYGIRDVRSTRDRDQPNVSAA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB1803-100 1x 100 µL
GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880789-100 1x 100 µL
GFAP (ASTRO/789), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Upstream Binding Protein 1 (UBP1) Mouse Monoclonal Antibody [Clone ID: OTI1C9]](https://cdn.genprice.uk/products/937/68dd18ba061270361e90840c/imageurl/cf808816.webp)
CF808816 100 µg
Upstream Binding Protein 1 (UBP1) Mouse Monoclonal Antibody [Clone ID: OTI1C9]
Sign In for Pricing
View Details