FCAR Peptide - C-terminal region
FCAR Peptide - C-terminal region
Product Specifications
Product Name Alternative
CD89
UniProt
Q92588
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FCAR Rabbit Polyclonal Antibody (orb586041) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_579808
Preservative
Lyophilized powder
AA Sequence
FDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRLHPPRLHDAE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040008-100 1x 100 µL
MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNCB0181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401266-100 1x 100 µL
Cytokeratin 8 (KRT8) (B22.1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741175-100 1x 100 µL
PTH / Parathyroid Hormone (N-Terminal) (PTH/1175), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details