Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPAR4 Peptide - C-terminal region

LPAR4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR23, LPA4, P2RY9, P2Y5-LIKE, P2Y9

UniProt

Q99677

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LPAR4 Rabbit Polyclonal Antibody (orb326507) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005287

Preservative

Lyophilized powder

AA Sequence

FIIPLILNVSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KATNB1 antibody
10R-4504 100 ul

KATNB1 antibody

Sign In for Pricing
View Details
Recombinant Rhesus Macaque METTL7A Protein, His (Fc)-Avi-tagged
METTL7A-2570R 50 µg

Recombinant Rhesus Macaque METTL7A Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Anti-Human UROD Polyclonal Antibody
PHC18901 100 μg

Anti-Human UROD Polyclonal Antibody

Sign In for Pricing
View Details
TIGD4
CSB-CL818256HU 10 μg Plasmid + 200 μL Glycerol

TIGD4

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Putative germin-like protein 2-3 (Os02g0491800, LOC_Os02g29020)
MBS1367605-01 0.02 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica Putative germin-like protein 2-3 (Os02g0491800, LOC_Os02g29020)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Putative germin-like protein 2-3 (Os02g0491800, LOC_Os02g29020)
MBS1367605-02 0.1 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica Putative germin-like protein 2-3 (Os02g0491800, LOC_Os02g29020)

Sign In for Pricing
View Details