Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LPAR4 Peptide - C-terminal region

LPAR4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GPR23, LPA4, P2RY9, P2Y5-LIKE, P2Y9

UniProt

Q99677

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LPAR4 Rabbit Polyclonal Antibody (orb326507) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005287

Preservative

Lyophilized powder

AA Sequence

FIIPLILNVSCSSVVLRTLRKPATLSQIGTNKKKVLKMITVHMAVFVVCF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GLUT8 Antibody
MBS8325376-01 0.03 mL

Anti-GLUT8 Antibody

Sign In for Pricing
View Details
Anti-GLUT8 Antibody
MBS8325376-02 0.05 mL

Anti-GLUT8 Antibody

Sign In for Pricing
View Details
Anti-GLUT8 Antibody
MBS8325376-03 0.1 mL

Anti-GLUT8 Antibody

Sign In for Pricing
View Details
Anti-GLUT8 Antibody
MBS8325376-04 0.2 mL

Anti-GLUT8 Antibody

Sign In for Pricing
View Details
Anti-GLUT8 Antibody
MBS8325376-05 5x 0.2 mL

Anti-GLUT8 Antibody

Sign In for Pricing
View Details
GLO1 Peptide - N-terminal region
MBS3236820-01 0.1 mg

GLO1 Peptide - N-terminal region

Sign In for Pricing
View Details