Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFA1 Peptide - N-terminal region

NDUFA1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CI-MWFE, MWFE, ZNF183

UniProt

O15239

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFA1 Rabbit Polyclonal Antibody (orb586047) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004532

Preservative

Lyophilized powder

AA Sequence

VMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2712), CF640R conjugate, 0.1mg/mL
BNC402712-100 1x 100 µL

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2712), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Selenof Mouse Gene Knockout Kit (CRISPR)
KN515530 1 Kit

Selenof Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TMED4 activation kit by CRISPRa
GA116655 1 Kit

Human TMED4 activation kit by CRISPRa

Sign In for Pricing
View Details
PDE11A Rabbit Polyclonal Antibody
AP00662SU-N 100 µL

PDE11A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse CD200 (OX-90) In Vivo Antibody - Low Endotoxin
ICH1195-25mg 25 mg

Anti-Mouse CD200 (OX-90) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
TARBP1 Human Gene Knockout Kit (CRISPR)
KN213800LP 1 Kit

TARBP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details