Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFA1 Peptide - N-terminal region

NDUFA1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CI-MWFE, MWFE, ZNF183

UniProt

O15239

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFA1 Rabbit Polyclonal Antibody (orb586047) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004532

Preservative

Lyophilized powder

AA Sequence

VMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLITRK2 Human Gene Knockout Kit (CRISPR)
KN415941 1 Kit

SLITRK2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Chloro-1,5-hexadiene (>90%)
TRC-C364010-100MG 100 mg

2-Chloro-1,5-hexadiene (>90%)

Sign In for Pricing
View Details
PAG (PAG1) Human Gene Knockout Kit (CRISPR)
KN419183 1 Kit

PAG (PAG1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgM,  15nm
GAF-003-15 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgM, 15nm

Sign In for Pricing
View Details
CD133 Antibody
KC-6151-01 50 μL

CD133 Antibody

Sign In for Pricing
View Details
CD133 Antibody
KC-6151-02 100 µL

CD133 Antibody

Sign In for Pricing
View Details