Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DOC2A Peptide - N-terminal region

DOC2A Peptide - N-terminal region

Product Specifications

Product Name Alternative

Doc2

UniProt

Q14183

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DOC2A Rabbit Polyclonal Antibody (orb586053) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003577

Preservative

Lyophilized powder

AA Sequence

HCSILRAKGLKPMDFNGLADPYVKLHLLPGACKANKLKTKTQRNTLNPVW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Embryonic Stem Mespu30 ELISA Kit
OM623039 96 Strip Well

Bovine Embryonic Stem Mespu30 ELISA Kit

Sign In for Pricing
View Details
Autophagy-related protein 101 Antibody (Fluoro647)
orb3165545 100 µg

Autophagy-related protein 101 Antibody (Fluoro647)

Sign In for Pricing
View Details
Anti-MR1 Antibody Picoband® Fluoro647 Conjugated
A00618-1-Fluoro647 100 µg/Vial

Anti-MR1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Recombinant Human Centromere Protein-Q
MBS145545-01 0.005 mg

Recombinant Human Centromere Protein-Q

Sign In for Pricing
View Details
Recombinant Human Centromere Protein-Q
MBS145545-02 0.02 mg

Recombinant Human Centromere Protein-Q

Sign In for Pricing
View Details
Recombinant Human Centromere Protein-Q
MBS145545-03 1 mg

Recombinant Human Centromere Protein-Q

Sign In for Pricing
View Details