Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DOC2A Peptide - N-terminal region

DOC2A Peptide - N-terminal region

Product Specifications

Product Name Alternative

Doc2

UniProt

Q14183

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DOC2A Rabbit Polyclonal Antibody (orb586053) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003577

Preservative

Lyophilized powder

AA Sequence

HCSILRAKGLKPMDFNGLADPYVKLHLLPGACKANKLKTKTQRNTLNPVW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM116B Protein Vector (Mouse) (pPM-C-HA)
PV177148 500 ng

FAM116B Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
(4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) methanamine hydrochloride
VPD10284-01 2 g

(4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) methanamine hydrochloride

Sign In for Pricing
View Details
(4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) methanamine hydrochloride
VPD10284-02 5 g

(4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl) methanamine hydrochloride

Sign In for Pricing
View Details
Nalgene Cryo Marker Black
CRY8333 4 / PCK

Nalgene Cryo Marker Black

Sign In for Pricing
View Details
TSTA3 Antibody
MBS9510347-01 0.05 mL

TSTA3 Antibody

Sign In for Pricing
View Details
TSTA3 Antibody
MBS9510347-02 0.1 mL

TSTA3 Antibody

Sign In for Pricing
View Details